Web Analysis for Ozcanlarmermergranit - ozcanlarmermergranit.com
Özcanlar Mermer Granit, güler yüzlü hizmet, güven ve kalitenin adresi
3.13
Rating by CuteStat
ozcanlarmermergranit.com is 6 years 1 week old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, ozcanlarmermergranit.com is SAFE to browse.
PageSpeed Score
88
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 1 |
H3 Headings: | Not Applicable | H4 Headings: | 3 |
H5 Headings: | 4 | H6 Headings: | 2 |
Total IFRAMEs: | Not Applicable | Total Images: | 7 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 94.199.200.87)
Kayseri Evden Eve Nakliyat | Kayseri Ev Taşıma firmaları
- kayserievdenevenakliyatfirmalari.com
Kayseri evden eve nakliyat, sektörü; şehir içi ev taşıma, şehirler arası nakliye hizmetleri sağlayan eşya taşıma ve nakliyat firmalar için tıklayın.
8,137,110
$
240.00
HTTP Header Analysis
HTTP/1.1 200 OK
X-Powered-By: PHP/7.0.30
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Sat, 05 May 2018 06:01:15 GMT
Accept-Ranges: bytes
Connection: close
X-Powered-By: PHP/7.0.30
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Sat, 05 May 2018 06:01:15 GMT
Accept-Ranges: bytes
Connection: close
Domain Information
Domain Registrar: | Lucky Elephant Domains, LLC |
---|---|
Registration Date: | May 3, 2018, 12:00 AM 6 years 1 week 5 days ago |
Last Modified: | May 3, 2018, 12:00 AM 6 years 1 week 5 days ago |
Domain Status: |
ok
|
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
cpns1.turhost.com | 37.230.110.110 | Türkiye | |
cpns2.turhost.com | 37.230.111.111 | Türkiye |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
ozcanlarmermergranit.com | A | 14400 |
IP: 94.199.200.87 |
ozcanlarmermergranit.com | NS | 86400 |
Target: cpns2.turdns.com |
ozcanlarmermergranit.com | NS | 86400 |
Target: cpns1.turdns.com |
ozcanlarmermergranit.com | SOA | 86400 |
MNAME: cpns1.turdns.com RNAME: csf.ofis.net Serial: 2018050303 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
ozcanlarmermergranit.com | MX | 14400 |
Target: ozcanlarmermergranit.com |
ozcanlarmermergranit.com | TXT | 14400 |
TXT: v=spf1 +a +mx +ip4:94.199.200.85 ~all |
Full WHOIS Lookup
Domain Name: OZCANLARMERMERGRANIT.COM
Registry Domain ID: 2259799844_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.nicproxy.com
Registrar URL: http://www.nicproxy.com
Updated Date: 2018-05-03T19:46:14Z
Creation Date: 2018-05-03T19:07:31Z
Registry Expiry Date: 2019-05-03T19:07:31Z
Registrar: Nics Telekomunikasyon Tic Ltd. Sti.
Registrar IANA ID: 1454
Registrar Abuse Contact Email: abuse@nicproxy.com
Registrar Abuse Contact Phone: +90 212 213 2963
Domain Status: ok https://icann.org/epp#ok
Name Server: CPNS1.TURHOST.COM
Name Server: CPNS2.TURHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-05-05T05:59:56Z
Registry Domain ID: 2259799844_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.nicproxy.com
Registrar URL: http://www.nicproxy.com
Updated Date: 2018-05-03T19:46:14Z
Creation Date: 2018-05-03T19:07:31Z
Registry Expiry Date: 2019-05-03T19:07:31Z
Registrar: Nics Telekomunikasyon Tic Ltd. Sti.
Registrar IANA ID: 1454
Registrar Abuse Contact Email: abuse@nicproxy.com
Registrar Abuse Contact Phone: +90 212 213 2963
Domain Status: ok https://icann.org/epp#ok
Name Server: CPNS1.TURHOST.COM
Name Server: CPNS2.TURHOST.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-05-05T05:59:56Z